Total number of results for Hippoglossoides elassodon are 1
Download
as Fasta All
| NPID | Sequence | Length | Organism | Family | Name | PMID | Peptide_REF |
|---|---|---|---|---|---|---|---|
| NP05226 |
SEEPPMSDLTFHMLRNMHRAKMEGEREQALNRNLLDEV
|
38 | Hippoglossoides elassodon | Sauvagine/corticotropin-releasing factor/urotensin I | urotensin I | 19215432#McMaster D, Itoh H, Maccannell KL, Rivier J, Rivier C, Vale W, Fryer JN, Tran TN, Lederis K#Isolation, Amino-Acid Sequence, Synthesis and Biological Properties of Urotensin I from Hippoglossoides elassodon#J Neuroendocrinol 1990 Dec 1;2(6):875-82 |